ELK3 purified MaxPab rabbit polyclonal antibody (D01P)
  • ELK3 purified MaxPab rabbit polyclonal antibody (D01P)

ELK3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002004-D01P
ELK3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ELK3 protein.
Información adicional
Size 100 ug
Gene Name ELK3
Gene Alias ERP|NET|SAP2
Gene Description ELK3, ETS-domain protein (SRF accessory protein 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MESAITLWQFLLQLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLSRALRYYYDKNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTRPVVSLPSTSEAAAASAFLASSVSAKISSLMLPNAASISSASPFSSRSPSLSPNSPLPSE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ELK3 (NP_005221.2, 1 a.a. ~ 407 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2004

Enviar un mensaje


ELK3 purified MaxPab rabbit polyclonal antibody (D01P)

ELK3 purified MaxPab rabbit polyclonal antibody (D01P)