ELA2 monoclonal antibody (M06C), clone 3B1
  • ELA2 monoclonal antibody (M06C), clone 3B1

ELA2 monoclonal antibody (M06C), clone 3B1

Ref: AB-H00001991-M06C
ELA2 monoclonal antibody (M06C), clone 3B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ELA2.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 200 uL
Gene Name ELA2
Gene Alias GE|HLE|HNE|NE|PMN-E
Gene Description elastase 2, neutrophil
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ELA2 (NP_001963, 168 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In condensed culture supernatant
Gene ID 1991
Clone Number 3B1
Iso type IgG1 Kappa

Enviar un mensaje


ELA2 monoclonal antibody (M06C), clone 3B1

ELA2 monoclonal antibody (M06C), clone 3B1