EIF5 monoclonal antibody (M02), clone 1D9-4B9
  • EIF5 monoclonal antibody (M02), clone 1D9-4B9

EIF5 monoclonal antibody (M02), clone 1D9-4B9

Ref: AB-H00001983-M02
EIF5 monoclonal antibody (M02), clone 1D9-4B9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant EIF5.
Información adicional
Size 100 ug
Gene Name EIF5
Gene Alias EIF-5|EIF-5A
Gene Description eukaryotic translation initiation factor 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF5 (AAH32866, 1 a.a. ~ 431 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1983
Clone Number 1D9-4B9
Iso type IgG1 Kappa

Enviar un mensaje


EIF5 monoclonal antibody (M02), clone 1D9-4B9

EIF5 monoclonal antibody (M02), clone 1D9-4B9