EIF4EBP1 monoclonal antibody (M02), clone 1F7
  • EIF4EBP1 monoclonal antibody (M02), clone 1F7

EIF4EBP1 monoclonal antibody (M02), clone 1F7

Ref: AB-H00001978-M02
EIF4EBP1 monoclonal antibody (M02), clone 1F7

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant EIF4EBP1.
Información adicional
Size 100 ug
Gene Name EIF4EBP1
Gene Alias 4E-BP1|4EBP1|BP-1|MGC4316|PHAS-I
Gene Description eukaryotic translation initiation factor 4E binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF4EBP1 (AAH04459, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1978
Clone Number 1F7
Iso type IgG2a Kappa

Enviar un mensaje


EIF4EBP1 monoclonal antibody (M02), clone 1F7

EIF4EBP1 monoclonal antibody (M02), clone 1F7