EIF4E polyclonal antibody (A01)
  • EIF4E polyclonal antibody (A01)

EIF4E polyclonal antibody (A01)

Ref: AB-H00001977-A01
EIF4E polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant EIF4E.
Información adicional
Size 50 uL
Gene Name EIF4E
Gene Alias CBP|EIF4E1|EIF4EL1|EIF4F|MGC111573
Gene Description eukaryotic translation initiation factor 4E
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLNRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF4E (AAH12611, 1 a.a. ~ 217 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1977

Enviar un mensaje


EIF4E polyclonal antibody (A01)

EIF4E polyclonal antibody (A01)