EIF4B purified MaxPab mouse polyclonal antibody (B02P)
  • EIF4B purified MaxPab mouse polyclonal antibody (B02P)

EIF4B purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00001975-B02P
EIF4B purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EIF4B protein.
Información adicional
Size 50 ug
Gene Name EIF4B
Gene Alias EIF-4B|PRO1843
Gene Description eukaryotic translation initiation factor 4B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGDVSTTWHSNDDDVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWRARPATDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDGYRDGPCRDMDRYGGR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EIF4B (AAH98437.1, 1 a.a. ~ 611 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1975

Enviar un mensaje


EIF4B purified MaxPab mouse polyclonal antibody (B02P)

EIF4B purified MaxPab mouse polyclonal antibody (B02P)