EGR2 purified MaxPab rabbit polyclonal antibody (D01P)
  • EGR2 purified MaxPab rabbit polyclonal antibody (D01P)

EGR2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001959-D01P
EGR2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EGR2 protein.
Información adicional
Size 100 ug
Gene Name EGR2
Gene Alias AT591|CMT1D|CMT4E|DKFZp686J1957|FLJ14547|KROX20
Gene Description early growth response 2 (Krox-20 homolog, Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MMTAKAVDKIPVTLSGFVHQLSDNIYPVEDLAATSVTIFPNAELGGPFDQMNGVAGDGMINIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGILQGVTSPASTTASSSVTSASPNPLATGPLGVCTMSQTQPDLDHLYSPPPPPPPYSGCAGDLYQDPSAFLSAATTSTSSSLAYPPPPSYPSPKPATDPGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EGR2 (NP_000390.2, 1 a.a. ~ 476 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1959

Enviar un mensaje


EGR2 purified MaxPab rabbit polyclonal antibody (D01P)

EGR2 purified MaxPab rabbit polyclonal antibody (D01P)