EGR1 polyclonal antibody (A01)
  • EGR1 polyclonal antibody (A01)

EGR1 polyclonal antibody (A01)

Ref: AB-H00001958-A01
EGR1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EGR1.
Información adicional
Size 50 uL
Gene Name EGR1
Gene Alias AT225|G0S30|KROX-24|NGFI-A|TIS8|ZIF-268|ZNF225
Gene Description early growth response 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EGR1 (NP_001955, 444 a.a. ~ 543 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1958

Enviar un mensaje


EGR1 polyclonal antibody (A01)

EGR1 polyclonal antibody (A01)