EGF polyclonal antibody (A01)
  • EGF polyclonal antibody (A01)

EGF polyclonal antibody (A01)

Ref: AB-H00001950-A01
EGF polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EGF.
Información adicional
Size 50 uL
Gene Name EGF
Gene Alias HOMG4|URG
Gene Description epidermal growth factor (beta-urogastrone)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHLREDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWKLRHA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EGF (NP_001954, 926 a.a. ~ 1025 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1950

Enviar un mensaje


EGF polyclonal antibody (A01)

EGF polyclonal antibody (A01)