EFNA3 monoclonal antibody (M10), clone 2H3
  • EFNA3 monoclonal antibody (M10), clone 2H3

EFNA3 monoclonal antibody (M10), clone 2H3

Ref: AB-H00001944-M10
EFNA3 monoclonal antibody (M10), clone 2H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EFNA3.
Información adicional
Size 100 ug
Gene Name EFNA3
Gene Alias EFL2|EPLG3|Ehk1-L|LERK3
Gene Description ephrin-A3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP,ELISA
Immunogen Prot. Seq RREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EFNA3 (NP_004943, 45 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1944
Clone Number 2H3
Iso type IgG2a Kappa

Enviar un mensaje


EFNA3 monoclonal antibody (M10), clone 2H3

EFNA3 monoclonal antibody (M10), clone 2H3