EFNA3 purified MaxPab mouse polyclonal antibody (B01P)
  • EFNA3 purified MaxPab mouse polyclonal antibody (B01P)

EFNA3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001944-B01P
EFNA3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EFNA3 protein.
Información adicional
Size 50 ug
Gene Name EFNA3
Gene Alias EFL2|EPLG3|Ehk1-L|LERK3
Gene Description ephrin-A3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EFNA3 (NP_004943.1, 1 a.a. ~ 238 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1944

Enviar un mensaje


EFNA3 purified MaxPab mouse polyclonal antibody (B01P)

EFNA3 purified MaxPab mouse polyclonal antibody (B01P)