EFNA3 polyclonal antibody (A01)
  • EFNA3 polyclonal antibody (A01)

EFNA3 polyclonal antibody (A01)

Ref: AB-H00001944-A01
EFNA3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EFNA3.
Información adicional
Size 50 uL
Gene Name EFNA3
Gene Alias EFL2|EPLG3|Ehk1-L|LERK3
Gene Description ephrin-A3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EFNA3 (NP_004943, 45 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1944

Enviar un mensaje


EFNA3 polyclonal antibody (A01)

EFNA3 polyclonal antibody (A01)