PHC2 monoclonal antibody (M01), clone 1F4
  • PHC2 monoclonal antibody (M01), clone 1F4

PHC2 monoclonal antibody (M01), clone 1F4

Ref: AB-H00001912-M01
PHC2 monoclonal antibody (M01), clone 1F4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PHC2.
Información adicional
Size 100 ug
Gene Name PHC2
Gene Alias EDR2|HPH2|MGC163502|PH2
Gene Description polyhomeotic homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,ELISA
Immunogen Prot. Seq PYLQESKEEGAPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGAATHNRRRASKASLPPLTKDTKKQPTGTVPLSVTAALQLTHSQE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PHC2 (NP_004418.2, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1912
Clone Number 1F4
Iso type IgG2a Kappa

Enviar un mensaje


PHC2 monoclonal antibody (M01), clone 1F4

PHC2 monoclonal antibody (M01), clone 1F4