PHC2 purified MaxPab mouse polyclonal antibody (B01P)
  • PHC2 purified MaxPab mouse polyclonal antibody (B01P)

PHC2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001912-B01P
PHC2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PHC2 protein.
Información adicional
Size 50 ug
Gene Name PHC2
Gene Alias EDR2|HPH2|MGC163502|PH2
Gene Description polyhomeotic homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTSGNGNSASSIAGTAPQNGENKPPQAIVKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKKKYAQGFLPEKLPQQDHTTTTDSEMEEPYLQESKEEGAPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGAATHNRRRASKASLPPLTKDTKKQPTGTVPLSVTAALQLTHSQEDSSRCSDNSSYEEPLSPISASSSTSRRRQGQRDLELPDMHMRDLVGMGHHFLPSE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PHC2 (NP_004418.2, 1 a.a. ~ 323 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1912

Enviar un mensaje


PHC2 purified MaxPab mouse polyclonal antibody (B01P)

PHC2 purified MaxPab mouse polyclonal antibody (B01P)