PHC1 purified MaxPab rabbit polyclonal antibody (D01P)
  • PHC1 purified MaxPab rabbit polyclonal antibody (D01P)

PHC1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001911-D01P
PHC1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PHC1 protein.
Información adicional
Size 100 ug
Gene Name PHC1
Gene Alias EDR1|HPH1|RAE28
Gene Description polyhomeotic homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq METESEQNSNSTNGSSSSGGSSRPQIAQMSLYERQAVQATIAASRQASSPNTSTTQQQTTTTQASINLATTSAAQLISRSQSVSSPSATTLTQSVLLGNTTSPPLNQSQAQMYLRVNRTLGRNVPLASQLILMPNGAVAAVQQEVPSAQSPGVHADADQVQNLAVRNQQASAQGPQMQGSTQKAIPPGASPVSSLSQASSQALAVAQASSGATNQSLNLSQAGGGSGNSIPGSMGPGGGGQAHGGLGQLPSSGMG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PHC1 (AAH73964.1, 1 a.a. ~ 957 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1911

Enviar un mensaje


PHC1 purified MaxPab rabbit polyclonal antibody (D01P)

PHC1 purified MaxPab rabbit polyclonal antibody (D01P)