EDNRA monoclonal antibody (M02), clone 2A5
  • EDNRA monoclonal antibody (M02), clone 2A5

EDNRA monoclonal antibody (M02), clone 2A5

Ref: AB-H00001909-M02
EDNRA monoclonal antibody (M02), clone 2A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EDNRA.
Información adicional
Size 100 ug
Gene Name EDNRA
Gene Alias ETA|ETRA
Gene Description endothelin receptor type A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EDNRA (AAH22511, 18 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1909
Clone Number 2A5
Iso type IgG2a Kappa

Enviar un mensaje


EDNRA monoclonal antibody (M02), clone 2A5

EDNRA monoclonal antibody (M02), clone 2A5