EDNRA polyclonal antibody (A01)
  • EDNRA polyclonal antibody (A01)

EDNRA polyclonal antibody (A01)

Ref: AB-H00001909-A01
EDNRA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EDNRA.
Información adicional
Size 50 uL
Gene Name EDNRA
Gene Alias ETA|ETRA
Gene Description endothelin receptor type A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq VISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EDNRA (AAH22511, 18 a.a. ~ 80 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1909

Enviar un mensaje


EDNRA polyclonal antibody (A01)

EDNRA polyclonal antibody (A01)