EDN2 purified MaxPab mouse polyclonal antibody (B01P)
  • EDN2 purified MaxPab mouse polyclonal antibody (B01P)

EDN2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001907-B01P
EDN2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EDN2 protein.
Información adicional
Size 50 ug
Gene Name EDN2
Gene Alias ET2|PPET2
Gene Description endothelin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EDN2 (NP_001947.1, 1 a.a. ~ 178 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1907

Enviar un mensaje


EDN2 purified MaxPab mouse polyclonal antibody (B01P)

EDN2 purified MaxPab mouse polyclonal antibody (B01P)