EDN1 purified MaxPab mouse polyclonal antibody (B01P)
  • EDN1 purified MaxPab mouse polyclonal antibody (B01P)

EDN1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001906-B01P
EDN1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EDN1 protein.
Información adicional
Size 50 ug
Gene Name EDN1
Gene Alias ET1|HDLCQ7
Gene Description endothelin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EDN1 (AAH09720.1, 1 a.a. ~ 212 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1906

Enviar un mensaje


EDN1 purified MaxPab mouse polyclonal antibody (B01P)

EDN1 purified MaxPab mouse polyclonal antibody (B01P)