EDG1 purified MaxPab rabbit polyclonal antibody (D01P)
  • EDG1 purified MaxPab rabbit polyclonal antibody (D01P)

EDG1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001901-D01P
EDG1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EDG1 protein.
Información adicional
Size 100 ug
Gene Name S1PR1
Gene Alias CHEDG1|D1S3362|ECGF1|EDG-1|EDG1|FLJ58121|S1P1
Gene Description sphingosine-1-phosphate receptor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EDG1 (NP_001391.2, 1 a.a. ~ 382 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1901

Enviar un mensaje


EDG1 purified MaxPab rabbit polyclonal antibody (D01P)

EDG1 purified MaxPab rabbit polyclonal antibody (D01P)