Ver mas grande
EDA monoclonal antibody (M16), clone 4D9
AB-H00001896-M16
Producto nuevo
EDA monoclonal antibody (M16), clone 4D9
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | EDA |
| Gene Alias | ED1|ED1-A1|ED1-A2|EDA1|EDA2|HED|XHED|XLHED |
| Gene Description | ectodysplasin A |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA |
| Immunogen Prot. Seq | ENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | EDA (NP_001005609.1, 245 a.a. ~ 389 a.a) partial recombinant protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 1896 |
| Clone Number | 4D9 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant EDA.