AB-H00001896-M10
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 100 ug |
Gene Name | EDA |
Gene Alias | ED1|ED1-A1|ED1-A2|EDA1|EDA2|HED|XHED|XLHED |
Gene Description | ectodysplasin A |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | ELISA |
Immunogen Prot. Seq | ENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | EDA (NP_001390.1 , 245 a.a. ~ 391 a.a) partial recombinant protein. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 1896 |
Clone Number | 1G4 |
Iso type | IgG2b Kappa |