ECT2 monoclonal antibody (M01), clone 5D4
  • ECT2 monoclonal antibody (M01), clone 5D4

ECT2 monoclonal antibody (M01), clone 5D4

Ref: AB-H00001894-M01
ECT2 monoclonal antibody (M01), clone 5D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ECT2.
Información adicional
Size 100 ug
Gene Name ECT2
Gene Alias FLJ10461|MGC138291
Gene Description epithelial cell transforming sequence 2 oncogene
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LPKENWLKMLCRHVANTICKADAENLIYTADPESFEVNTKDMDSTLSRASRAIKKTSKKVTRAFSFSKTPKRALRRALMTSHGSVEGRSPSSNDKHVMSR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ECT2 (AAH06838.1, 46 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1894
Clone Number 5D4
Iso type IgG2a Kappa

Enviar un mensaje


ECT2 monoclonal antibody (M01), clone 5D4

ECT2 monoclonal antibody (M01), clone 5D4