ECHS1 purified MaxPab rabbit polyclonal antibody (D01P)
  • ECHS1 purified MaxPab rabbit polyclonal antibody (D01P)

ECHS1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001892-D01P
ECHS1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ECHS1 protein.
Información adicional
Size 100 ug
Gene Name ECHS1
Gene Alias SCEH
Gene Description enoyl Coenzyme A hydratase, short chain, 1, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MAALRVLLSCARGPLRPPVRCPAWRPFASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ECHS1 (NP_004083.2, 1 a.a. ~ 290 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1892

Enviar un mensaje


ECHS1 purified MaxPab rabbit polyclonal antibody (D01P)

ECHS1 purified MaxPab rabbit polyclonal antibody (D01P)