ECH1 purified MaxPab rabbit polyclonal antibody (D01P)
  • ECH1 purified MaxPab rabbit polyclonal antibody (D01P)

ECH1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001891-D01P
ECH1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ECH1 protein.
Información adicional
Size 100 ug
Gene Name ECH1
Gene Alias HPXEL
Gene Description enoyl Coenzyme A hydratase 1, peroxisomal
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAGIVASRRLRDLLTRRLTGSNYPGLSISLRLTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ECH1 (NP_001389.2, 1 a.a. ~ 328 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1891

Enviar un mensaje


ECH1 purified MaxPab rabbit polyclonal antibody (D01P)

ECH1 purified MaxPab rabbit polyclonal antibody (D01P)