Ver mas grande
EBF1 monoclonal antibody (M01A), clone 1C12
AB-H00001879-M01A
Producto nuevo
EBF1 monoclonal antibody (M01A), clone 1C12
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 200 uL |
| Gene Name | EBF1 |
| Gene Alias | COE1|EBF|FLJ39389|FLJ41763|O/E-1|OLF1 |
| Gene Description | early B-cell factor 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | MFGIQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFSKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTPS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | EBF1 (AAH38805, 1 a.a. ~ 591 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 1879 |
| Clone Number | 1C12 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a full-length recombinant EBF1.