E4F1 purified MaxPab mouse polyclonal antibody (B01P)
  • E4F1 purified MaxPab mouse polyclonal antibody (B01P)

E4F1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001877-B01P
E4F1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human E4F1 protein.
Información adicional
Size 50 ug
Gene Name E4F1
Gene Alias E4F|MGC99614
Gene Description E4F transcription factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MEGAMAVRVTAAHTAEAQAEAGREAGEGAVAAVAAALAPSGFLGLPAPFSEEDEDDVHRCGRCQAEFTALEDFVQHKIQKACQRAPPEALPATPATTALLGQEVVPAAPGPEEPITVAHIVVEAASLAADISHASDLVGGGHIKEVIVAAEAELGDGEMAEAPGSPHQQGLGLAGEGEQAQVKLLVNKDGRYVCALCHKTFKTGSILKAHMVTHSSRKDHECKLCGASFRTKGSLIRHHRRHTDERPYKCSKCGK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen E4F1 (AAH80524.1, 1 a.a. ~ 784 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1877

Enviar un mensaje


E4F1 purified MaxPab mouse polyclonal antibody (B01P)

E4F1 purified MaxPab mouse polyclonal antibody (B01P)