E2F3 polyclonal antibody (A01)
  • E2F3 polyclonal antibody (A01)

E2F3 polyclonal antibody (A01)

Ref: AB-H00001871-A01
E2F3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant E2F3.
Información adicional
Size 50 uL
Gene Name E2F3
Gene Alias DKFZp686C18211|E2F-3|KIAA0075|MGC104598
Gene Description E2F transcription factor 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MQSGGGVKTDDTSTLNSLCGYAWVYVWEEKQRCRLSSFFSSSASIPGLLPSHTLDLVQNVGVVLDEALGWGRERELCVKCLLEMHCGVFSCMGNHLCQAFPHFPYLSHLVSCLCFQLCVILFASCTKLIFSKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen E2F3 (AAH16847, 1 a.a. ~ 133 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1871

Enviar un mensaje


E2F3 polyclonal antibody (A01)

E2F3 polyclonal antibody (A01)