E2F2 purified MaxPab rabbit polyclonal antibody (D01P)
  • E2F2 purified MaxPab rabbit polyclonal antibody (D01P)

E2F2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001870-D01P
E2F2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human E2F2 protein.
Información adicional
Size 100 ug
Gene Name E2F2
Gene Alias E2F-2
Gene Description E2F transcription factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPGTCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDHLIQSCSLSFKHLTEDKANKRLAYVTYQDI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen E2F2 (AAH53676.1, 1 a.a. ~ 437 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1870

Enviar un mensaje


E2F2 purified MaxPab rabbit polyclonal antibody (D01P)

E2F2 purified MaxPab rabbit polyclonal antibody (D01P)