DVL3 monoclonal antibody (M04), clone 4H2
  • DVL3 monoclonal antibody (M04), clone 4H2

DVL3 monoclonal antibody (M04), clone 4H2

Ref: AB-H00001857-M04
DVL3 monoclonal antibody (M04), clone 4H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DVL3.
Información adicional
Size 50 ug
Gene Name DVL3
Gene Alias KIAA0208
Gene Description dishevelled, dsh homolog 3 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DVL3 (AAH32459, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1857
Clone Number 4H2
Iso type IgG1 Kappa

Enviar un mensaje


DVL3 monoclonal antibody (M04), clone 4H2

DVL3 monoclonal antibody (M04), clone 4H2