DUT MaxPab rabbit polyclonal antibody (D01)
  • DUT MaxPab rabbit polyclonal antibody (D01)

DUT MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001854-D01
DUT MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DUT protein.
Información adicional
Size 100 uL
Gene Name DUT
Gene Alias FLJ20622|dUTPase
Gene Description deoxyuridine triphosphatase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DUT (NP_001020419.1, 1 a.a. ~ 252 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1854

Enviar un mensaje


DUT MaxPab rabbit polyclonal antibody (D01)

DUT MaxPab rabbit polyclonal antibody (D01)