DUT purified MaxPab mouse polyclonal antibody (B01P)
  • DUT purified MaxPab mouse polyclonal antibody (B01P)

DUT purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001854-B01P
DUT purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DUT protein.
Información adicional
Size 50 ug
Gene Name DUT
Gene Alias FLJ20622|dUTPase
Gene Description deoxyuridine triphosphatase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DUT (NP_001020419.1, 1 a.a. ~ 252 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1854

Enviar un mensaje


DUT purified MaxPab mouse polyclonal antibody (B01P)

DUT purified MaxPab mouse polyclonal antibody (B01P)