DUSP9 polyclonal antibody (A01)
  • DUSP9 polyclonal antibody (A01)

DUSP9 polyclonal antibody (A01)

Ref: AB-H00001852-A01
DUSP9 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DUSP9.
Información adicional
Size 50 uL
Gene Name DUSP9
Gene Alias MKP-4|MKP4
Gene Description dual specificity phosphatase 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DUSP9 (NP_001386, 174 a.a. ~ 278 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1852

Enviar un mensaje


DUSP9 polyclonal antibody (A01)

DUSP9 polyclonal antibody (A01)