DUSP3 monoclonal antibody (M01A), clone 5B7
  • DUSP3 monoclonal antibody (M01A), clone 5B7

DUSP3 monoclonal antibody (M01A), clone 5B7

Ref: AB-H00001845-M01A
DUSP3 monoclonal antibody (M01A), clone 5B7

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant DUSP3.
Información adicional
Size 200 uL
Gene Name DUSP3
Gene Alias VHR
Gene Description dual specificity phosphatase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DUSP3 (AAH02682, 1 a.a. ~ 185 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 1845
Clone Number 5B7
Iso type IgG2a Kappa

Enviar un mensaje


DUSP3 monoclonal antibody (M01A), clone 5B7

DUSP3 monoclonal antibody (M01A), clone 5B7