DUSP1 monoclonal antibody (M02), clone 4H7
  • DUSP1 monoclonal antibody (M02), clone 4H7

DUSP1 monoclonal antibody (M02), clone 4H7

Ref: AB-H00001843-M02
DUSP1 monoclonal antibody (M02), clone 4H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DUSP1.
Información adicional
Size 100 ug
Gene Name DUSP1
Gene Alias CL100|HVH1|MKP-1|MKP1|PTPN10
Gene Description dual specificity phosphatase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DUSP1 (NP_004408, 305 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1843
Clone Number 4H7
Iso type IgG1 Kappa

Enviar un mensaje


DUSP1 monoclonal antibody (M02), clone 4H7

DUSP1 monoclonal antibody (M02), clone 4H7