DTYMK polyclonal antibody (A01)
  • DTYMK polyclonal antibody (A01)

DTYMK polyclonal antibody (A01)

Ref: AB-H00001841-A01
DTYMK polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DTYMK.
Información adicional
Size 50 uL
Gene Name DTYMK
Gene Alias CDC8|FLJ44192|TMPK|TYMK
Gene Description deoxythymidylate kinase (thymidylate kinase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq VAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGELWK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DTYMK (NP_036277, 103 a.a. ~ 212 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1841

Enviar un mensaje


DTYMK polyclonal antibody (A01)

DTYMK polyclonal antibody (A01)