DTNB purified MaxPab mouse polyclonal antibody (B01P)
  • DTNB purified MaxPab mouse polyclonal antibody (B01P)

DTNB purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001838-B01P
DTNB purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DTNB protein.
Información adicional
Size 50 ug
Gene Name DTNB
Gene Alias MGC17163|MGC57126
Gene Description dystrobrevin, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIYYQLNKRLHSTHQISVEQSISLLLNFMTAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTAVFEGPSFGYTEHSVRTCFPQQRKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCRCESMMGFR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DTNB (AAH49366.1, 1 a.a. ~ 609 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1838

Enviar un mensaje


DTNB purified MaxPab mouse polyclonal antibody (B01P)

DTNB purified MaxPab mouse polyclonal antibody (B01P)