DSC2 MaxPab rabbit polyclonal antibody (D01)
  • DSC2 MaxPab rabbit polyclonal antibody (D01)

DSC2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001824-D01
DSC2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DSC2 protein.
Información adicional
Size 100 uL
Gene Name DSC2
Gene Alias ARVD11|CDHF2|DG2|DGII/III|DKFZp686I11137|DSC3
Gene Description desmocollin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MEAARPSGSWNGALCRLLLLTLAILIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTAANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVLKKRHTKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTFTIFEN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DSC2 (NP_004940.1, 1 a.a. ~ 847 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1824

Enviar un mensaje


DSC2 MaxPab rabbit polyclonal antibody (D01)

DSC2 MaxPab rabbit polyclonal antibody (D01)