SLC26A3 monoclonal antibody (M01), clone 2E3
  • SLC26A3 monoclonal antibody (M01), clone 2E3

SLC26A3 monoclonal antibody (M01), clone 2E3

Ref: AB-H00001811-M01
SLC26A3 monoclonal antibody (M01), clone 2E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC26A3.
Información adicional
Size 100 ug
Gene Name SLC26A3
Gene Alias CLD|DRA
Gene Description solute carrier family 26, member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq TQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCPSPIYFANIGFFRRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC26A3 (NP_000102, 503 a.a. ~ 600 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1811
Clone Number 2E3
Iso type IgG2a Kappa

Enviar un mensaje


SLC26A3 monoclonal antibody (M01), clone 2E3

SLC26A3 monoclonal antibody (M01), clone 2E3