DPYSL2 monoclonal antibody (M01), clone 1F11
  • DPYSL2 monoclonal antibody (M01), clone 1F11

DPYSL2 monoclonal antibody (M01), clone 1F11

Ref: AB-H00001808-M01
DPYSL2 monoclonal antibody (M01), clone 1F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DPYSL2.
Información adicional
Size 100 ug
Gene Name DPYSL2
Gene Alias CRMP2|DHPRP2|DRP-2|DRP2
Gene Description dihydropyrimidinase-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq PRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DPYSL2 (NP_001377.1, 470 a.a. ~ 571 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1808
Clone Number 1F11
Iso type IgG2a Kappa

Enviar un mensaje


DPYSL2 monoclonal antibody (M01), clone 1F11

DPYSL2 monoclonal antibody (M01), clone 1F11