DPYS monoclonal antibody (M01), clone 3B1
  • DPYS monoclonal antibody (M01), clone 3B1

DPYS monoclonal antibody (M01), clone 3B1

Ref: AB-H00001807-M01
DPYS monoclonal antibody (M01), clone 3B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DPYS.
Información adicional
Size 100 ug
Gene Name DPYS
Gene Alias DHP|DHPase
Gene Description dihydropyrimidinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq AVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAGTRKQAHP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DPYS (NP_001376, 422 a.a. ~ 519 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1807
Clone Number 3B1
Iso type IgG1 Kappa

Enviar un mensaje


DPYS monoclonal antibody (M01), clone 3B1

DPYS monoclonal antibody (M01), clone 3B1