DPYS polyclonal antibody (A01)
  • DPYS polyclonal antibody (A01)

DPYS polyclonal antibody (A01)

Ref: AB-H00001807-A01
DPYS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DPYS.
Información adicional
Size 50 uL
Gene Name DPYS
Gene Alias DHP|DHPase
Gene Description dihydropyrimidinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAGTRKQAHP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DPYS (NP_001376, 422 a.a. ~ 519 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1807

Enviar un mensaje


DPYS polyclonal antibody (A01)

DPYS polyclonal antibody (A01)