DPH2 monoclonal antibody (M02), clone 5B10
  • DPH2 monoclonal antibody (M02), clone 5B10

DPH2 monoclonal antibody (M02), clone 5B10

Ref: AB-H00001802-M02
DPH2 monoclonal antibody (M02), clone 5B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DPH2.
Información adicional
Size 100 ug
Gene Name DPH2
Gene Alias DPH2L2
Gene Description DPH2 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq RQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFGRRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DPH2 (NP_001375, 125 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1802
Clone Number 5B10
Iso type IgG2a Kappa

Enviar un mensaje


DPH2 monoclonal antibody (M02), clone 5B10

DPH2 monoclonal antibody (M02), clone 5B10