DYNC1LI2 purified MaxPab rabbit polyclonal antibody (D01P)
  • DYNC1LI2 purified MaxPab rabbit polyclonal antibody (D01P)

DYNC1LI2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001783-D01P
DYNC1LI2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DYNC1LI2 protein.
Información adicional
Size 100 ug
Gene Name DYNC1LI2
Gene Alias DNCLI2|LIC2
Gene Description dynein, cytoplasmic 1, light intermediate chain 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPVGVEKKLLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSKLPSGKNILVFGEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWILDGDLYHKGLLKFAVSAESLPETLVIFVADMSRPWTVMESLQKWASVLREHIDKMKIPPEKMRELERKFVKDFQDYMEPEEGCQGSPQRRGPLTSGSDEENVALPLGDNVLTHNLGIPVLVVCTKCDAVSVLEKEHDYRDEHLDFIQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DYNC1LI2 (AAH25959.1, 1 a.a. ~ 492 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1783

Enviar un mensaje


DYNC1LI2 purified MaxPab rabbit polyclonal antibody (D01P)

DYNC1LI2 purified MaxPab rabbit polyclonal antibody (D01P)