DMWD monoclonal antibody (M01), clone 3F5
  • DMWD monoclonal antibody (M01), clone 3F5

DMWD monoclonal antibody (M01), clone 3F5

Ref: AB-H00001762-M01
DMWD monoclonal antibody (M01), clone 3F5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DMWD.
Información adicional
Size 100 ug
Gene Name DMWD
Gene Alias D19S593E|DMR-N9|DMRN9|gene59
Gene Description dystrophia myotonica, WD repeat containing
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq GGEKPSGPVPRSRLDPAKVLGTALCPRIHEVPLLEPLVCKKIAQERLTVLLFLEDCIITACQEGLICTWARPGKAGISSQPGNSPSGTVV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DMWD (AAH19266, 245 a.a. ~ 334 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1762
Clone Number 3F5
Iso type IgG1 Kappa

Enviar un mensaje


DMWD monoclonal antibody (M01), clone 3F5

DMWD monoclonal antibody (M01), clone 3F5