DMD monoclonal antibody (M07), clone 3A11
  • DMD monoclonal antibody (M07), clone 3A11

DMD monoclonal antibody (M07), clone 3A11

Ref: AB-H00001756-M07
DMD monoclonal antibody (M07), clone 3A11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant DMD.
Información adicional
Size 100 ug
Gene Name DMD
Gene Alias BMD|CMD3B|DXS142|DXS164|DXS206|DXS230|DXS239|DXS268|DXS269|DXS270|DXS272
Gene Description dystrophin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq MREQLKGHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DMD (AAH28720.1, 1 a.a. ~ 635 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1756
Clone Number 3A11
Iso type IgG1 Kappa

Enviar un mensaje


DMD monoclonal antibody (M07), clone 3A11

DMD monoclonal antibody (M07), clone 3A11