DMD purified MaxPab rabbit polyclonal antibody (D01P)
  • DMD purified MaxPab rabbit polyclonal antibody (D01P)

DMD purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001756-D01P
DMD purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DMD protein.
Información adicional
Size 100 ug
Gene Name DMD
Gene Alias BMD|CMD3B|DXS142|DXS164|DXS206|DXS230|DXS239|DXS268|DXS269|DXS270|DXS272
Gene Description dystrophin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MREQLKGHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DMD (NP_004007.1, 1 a.a. ~ 635 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1756

Enviar un mensaje


DMD purified MaxPab rabbit polyclonal antibody (D01P)

DMD purified MaxPab rabbit polyclonal antibody (D01P)