DLX6 monoclonal antibody (M06), clone 2D7
  • DLX6 monoclonal antibody (M06), clone 2D7

DLX6 monoclonal antibody (M06), clone 2D7

Ref: AB-H00001750-M06
DLX6 monoclonal antibody (M06), clone 2D7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DLX6.
Información adicional
Size 100 ug
Gene Name DLX6
Gene Alias MGC125282|MGC125283|MGC125284|MGC125285
Gene Description distal-less homeobox 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PYASGGGNSYNHRSLAAYPYMSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLX6 (XP_376652, 71 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1750
Clone Number 2D7
Iso type IgG2a Kappa

Enviar un mensaje


DLX6 monoclonal antibody (M06), clone 2D7

DLX6 monoclonal antibody (M06), clone 2D7