DLX6 purified MaxPab rabbit polyclonal antibody (D01P)
  • DLX6 purified MaxPab rabbit polyclonal antibody (D01P)

DLX6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001750-D01P
DLX6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DLX6 protein.
Información adicional
Size 100 ug
Gene Name DLX6
Gene Alias MGC125282|MGC125283|MGC125284|MGC125285
Gene Description distal-less homeobox 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DLX6 (AAH69363.1, 1 a.a. ~ 175 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1750

Enviar un mensaje


DLX6 purified MaxPab rabbit polyclonal antibody (D01P)

DLX6 purified MaxPab rabbit polyclonal antibody (D01P)