DLX6 polyclonal antibody (A01)
  • DLX6 polyclonal antibody (A01)

DLX6 polyclonal antibody (A01)

Ref: AB-H00001750-A01
DLX6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DLX6.
Información adicional
Size 50 uL
Gene Name DLX6
Gene Alias MGC125282|MGC125283|MGC125284|MGC125285
Gene Description distal-less homeobox 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PYASGGGNSYNHRSLAAYPYMSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLX6 (XP_376652, 71 a.a. ~ 160 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1750

Enviar un mensaje


DLX6 polyclonal antibody (A01)

DLX6 polyclonal antibody (A01)